Proteodie txt

créé le: 20170924
mis à jour le: 20190522
généré le:20191123_223626

Résumé proteodie 

  • pour générer une protéodie:
  • chercher le code fasta sur les sites uniprot nweb ou ncbi nweb
  • ajouter une entrée ( en créant un bloc de texte dans le fichier proteodie ana txt
  • lancer le batch %BASE%\proteodie\bin\proteodie.bat ( qui lance l'atelier atelier proteodie gen )
  • copier le code fasta avec le nom de la protéine dans la première ligne dans le fichier ouvert par notepad (fic tmp prot)
  • sauvegarder et fermer le fichier.
  • les fichiers de stimulation et d'inhibition de la protéodie au format .abc sont généré sous répertoire abc  cf domaine gen abc file 
  • ouvrir le fichier midi dans musescore et le sauvegarder ensuite au format .mp3
  • le retrouver dans répertoire mp3 
  • pour faire une composition de plusieurs protéodies à la suite, éditer un fichier .abc dans le répertoire répertoire abc  contiendra le code abc des différentes protéodies en séparant par des silences (voir le code des silences dans des fichiers similaires cf domaine gen abc file )

  • copier le chemin du fichier abc de la protéodie que l'on veut généré au format .mid dans le tableau domaine abc edt file 
  • lancer l'atelier atelier abc2mid  qui génère le fichier midi dans le répertoire répertoire mid  et mettre à jour ensuite domaine midi file 

    Evolution proteodie 

  • atelier qui gènére les différents fichiers à partir du nom de la protéine et du code fasta copié dans un fichier .txt dans notepad
  • générer toujours en même temps stimulation et inhibition que l'on doit retrouver appariés dans les documents

    Proteodie debug

  • 06/06/2017 00:12:52 atelier homologie reg exp gen  la sequence n'est pas prise en compte - fichier avec nom de variable crée sous bin

    Spécification de proteodie 

  • 18/06/2017 histogramme AA pour une protéine, intervalle, ...

  • atelier proteodie batch  atelier qui gènére les différents fichiers à partir du nom de la protéine et du code fasta copié dans un fichier .txt dans notepad

  • générer toujours en même temps stimulation et inhibition que l'on doit retrouver appariés dans les documents

  • 31/05/2017 atelier d'édition des chaînes regexp de recherche d'homologies

  • se baser sur atelier proteodie batch  qui appelera un atelier composant les regexp par update : pour la stimulation et l'inhibition.

  • 05/06/2017 première version des ateliers complète avec batch de lancement batch proteodie  batch homologie 

    Phi blast: :20170605

    https://blast.ncbi.nlm.nih.gov/Blast.cgi?CMD=Web&PAGE_TYPE=BlastDocs&DOC_TYPE=BlastHelp

    PHI-BLAST Pattern

    PHI-BLAST (Pattern-Hit Initiated BLAST) is a search program that combines matching of regular expressions with local alignments surrounding the match. Given a protein sequence S and a regular expression pattern P occurring in S, PHI-BLAST helps answer the question:

    What other protein sequences both contain an occurrence of P and are homologous to S in the vicinity of the pattern occurrences?

    PHI-BLAST may be preferable to just searching for pattern occurrences because it filters out those cases where the pattern occurrence is probably random and not indicative of homology. See PHI-BLAST pattern syntax for details.

    Test grep regexp proteodie: :20170606

    CPTVGEKMQEKMQEKMQGDILNEKMQDILNEKMQDILNEKMQEKMQEKMQDILNCPTVGEKMQH grep "CPTVGEKMQEKMQEKMQGDILNEKMQDILNEKMQDILNEKMQEKMQEKMQDILNCPTVGEKMQH" C:\mt\proteodie\homologie\regexp\phenylalanine_ammonia_lyase_1_Pisum_sativum_sequence.txt

    Proteodie: :20170219

  • 4 ajout d'acides aminés par seconde
  • Anvil Studio: une noire = 1 beat , tempo: nombre de beat par minutes 4 acide par secondes * 60 secondes pour une minute donne un tempo de = 240

    ProtéineProteine: :20170219

    Glossaire preoteine : :20170630

    keywordmot_cle_protinfo  
    Receptor  Récepteur  pour trouver les récepteurs d'une hormone, qui sont des protéines - indication de Joël Sternheimer pour l'asthme
    nbr      
    keyword    
    1.00000    

    Références preoteine 

      Prédiction_de_la_structure_des_protéines_ ;https://fr.wikipedia.org/wiki/Prédiction_de_la_structure_des_protéines;

  • proteine alimentaire   fonctions_des_protéines_
  • banque de donnée protéines en libre accés:   uniprot_ ;http://www.uniprot.org

    Ncbi

      ncbi_;www.ncbi.nlm.nih.gov/protein; Blast

      Blast_   readme_blast_ ftp://ftp.ncbi.nlm.nih.gov/pub/factsheets/HowTo_BLASTGuide.pdf

    exemple: http://www.uniprot.org/uniprot/P01236 https://www.ncbi.nlm.nih.gov/protein/281185509?report=fasta

  • Choline O acetyltransferase(OS=Homo sapiens GN=CHAT PE=1 SV=4)   choline o acetyltransferase  tableau choline o acetyltransferase 

    Références proteodie  références midi 

  • tableau acide amine 
  • domaine proteo domaine proteo txh tableau proteo txh tableau txh doc  tableau des fichiers atelier de protéines
  • midi atl txtdomaine midi domaine notes musique jpg 
  • atelier proteo analyse proteodie  back office proteodie  message proteodie développement proteo 
  • batch proteo dir 

    g:\mt\proteodie\bin g:\mt\proteodie\fic\mp3

    Procédure proteodie 

  • implémenter le template   proteine tpt  dans le domaine tableau proteo txh  en renommant le template avec le nom de la protéine
  • suivre les indications dans le template.
  • exécuter le tableau tableau   prot  implémenté à partir de atelier proteodie tab tpt 
  • cela générera les fichiers abc des protéodies stimulatrice et inhibitrice de la protéine on a les chemin dans les spécification CSV_EDT du tableau que l'on retrouve après exécution en fin de tableau.
  • aller dans atelier midi  tableau domaine abc edt file  en post-commentaire on mentionne le tableau domaine abc file 
  • aller dans le tableau domaine abc file  récupérer les lignes des fichiers abc dont on veut générer les midi et les insérer dans le tableau domaine abc edt file 
  • exécuter le tableau atelier abc2mid  qui récupère les lignes dans le tableau domaine abc edt file 
  • aller dans le tableau domaine midi file  et l'exécuter pour le mettre à jour et vérifier que les nouveaux fichiers midi sont bien présents.
  • lancer AnvilStudio commande dans commande midi  pour jouer la protéodie en ouvrant le fichier midi correspondant.

    Tableau références proteodie  

    lien  url  
      prl sheep prolactin ovis aries     
      zp3 human zona pellucida sperm binding protein 3     
      tyrosine hydroxylase     
      troponin c homo sapiens 000     
      troponin c homo sapiens   troponin_c_homo_sapiens_txh_ 
      tert human telomerase reverse transcriptase     
      tau human     
      serotonine     
      proteine tpt     
      prolactine humaine     
      prolactine bovine     
      phenylalanine ammonia lyase 1 pisum sativum     
      p07315 crgc human gamma crystallin c     
      p05813 crba1 human beta crystallin a3     
      p02489 cryaa human alpha crystallin a     
      oxytocin neurophysin 1     
      oxytocin aa sequence     
      oxyr human oxytocin receptor     
      ocytocine     
      neu1 human oxytocin neurophysin     
      indolethylamine n methyltransferase homo sapiens nom fasta    
      indolethylamine n methyltransferase homo sapiens     
      gnrh     
      gamme aa sti fasta     
      endorphine     
      dopamine hydroxylase     
      dopa decarboxylase     
      dhea     
      ddc human aromatic l'amino acid decarboxylase     
      collagen alpha1     
      clat human choline o acetyltransferase     
      choline o acetyltransferase     
      alpha 1 antitrypsine     
      acides amines     
      aaa92870 1 crystallin partial homo sapiens     
    nbr    
    lien    
    35.000000  

    Macro vim proteodie 

    map s :s/\(.\)/\1;/g &z:s/;/;/g map s :s/;/; /g

    Commande proteo Commande proteodie 

    start g:\mt\bin\perl.exe g:\mt\fic\pl\traite_csv.pl -t proteo_export_atl start g:\mt\proteodie\bin\proteo_dir.bat

    Atelier proteo 

    Tableau proteodie  tpt archive:atelier template d'une protéodie

  • ligne d'édition de la protéodie hominh dans le fichier ABC

    CSV_EDTn:tableau deuxieme piste abc : :%PROTEINE%_homo_abc_deuxieme_piste_homo:fichier abc de la protéodie stimulatrice de %NOMPROT% cf %FICPROT_STI% ::%FICPROT_STI%,a: CSV_EDTn:\6: :%PROTEINE%_homo_abc:fichier abc de la protéodie stimulatrice de %NOMPROT% cf %FICPROT_STI% ::%FICPROT_STI%,a: CSV_EDTn:\6: :%PROTEINE%_homo_abc_str:code abc de la protéodie homologue inhibitrice de %NOMPROT%: CSV_EDT:<\1_img>Jpg_dir%\\0.000000_img_inh%,z_img% ::%PROTEINE%_inh_part:fichier txh de la partition de la protéodie inhibitrice de %NOMPROT% cf %FICPART_INH%:32,%part_sep_bloc% inh ,4:%FICPART_INH%, a::%CPOV%inh 1:%RC%%CPFV%: CSV_EDT:\0: :%PROTEINE%_sti_fasta_str:code FASTA de %PROTEINE %NOMPROT% : ::sB: CSV_EDT:(\6 \0):0:%PROTEINE%_sti_fasta_colore_str:protéodie stimulatrice de %NOMPROT% code FASTA coloré: 80::sB:

    Atelier tableau proteodie  tpt :atelier template d'une protéodie Pseudo code fasta et ABC pour signaler une absence d'acide aminé ou de note donc un silence

    CodeFastaCodeAANote_sti_GBNote_inh_GBABC_stiABC_inhABC_homNote_inh_Homoregexp_inh_Homo
    M  Met  3A  3F  A  F  F  3F  CPTV  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    P  Pro  3F  3A  F  A  A  3A  EKMQ  
    I  Ile  3G  3G  G  G  G  3G  DILN  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    A  Ala  3C  4D  C  d  d  4D  W  
    G  Gly  2A  4F  A,  f  z  z  ds  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    I  Ile  3G  3G  G  G  G  3G  DILN  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    T  Thr  3F  3A  F  A  A  3A  EKMQ  
    W  Trp  4D  3C  d  C  C  3C  A  
    C  Cys  3F  3A  F  A  A  3A  EKMQ  
    V  Val  3F  3A  F  A  A  3A  EKMQ  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    G  Gly  2A  4F  A,  f  z  z  ds  
    C  Cys  3F  3A  F  A  A  3A  EKMQ  
    S  Ser  3E  3Bb  E  _B  _B  3Bb  H  
    S  Ser  3E  3Bb  E  _B  _B  3Bb  H  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    H  His  3Bb  3E  _B  E  E  3E  S  
    W  Trp  4D  3C  d  C  C  3C  A  
    S  Ser  3E  3Bb  E  _B  _B  3Bb  H  
    Y  Tyr  4C  3D  c  D  z  z  ds  
    G  Gly  2A  4F  A,  f  z  z  ds  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    R  Arg  4C  3D  c  D  z  z  ds  
    P  Pro  3F  3A  F  A  A  3A  EKMQ  
    G  Gly  2A  4F  A,  f  z  z  ds  
    G  Gly  2A  4F  A,  f  z  z  ds  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    R  Arg  4C  3D  c  D  z  z  ds  
    D  Asp  3G  3G  G  G  G  3G  DILN  
    A  Ala  3C  4D  C  d  d  4D  W  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    N  Asn  3G  3G  G  G  G  3G  DILN  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    I  Ile  3G  3G  G  G  G  3G  DILN  
    D  Asp  3G  3G  G  G  G  3G  DILN  
    S  Ser  3E  3Bb  E  _B  _B  3Bb  H  
    F  Phe  3B  3Eb  B  _E  z  z  ds  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    I  Ile  3G  3G  G  G  G  3G  DILN  
    V  Val  3F  3A  F  A  A  3A  EKMQ  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    V  Val  3F  3A  F  A  A  3A  EKMQ  
    G  Gly  2A  4F  A,  f  z  z  ds  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    A  Ala  3C  4D  C  d  d  4D  W  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    T  Thr  3F  3A  F  A  A  3A  EKMQ  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    R  Arg  4C  3D  c  D  z  z  ds  
    F  Phe  3B  3Eb  B  _E  z  z  ds  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    C  Cys  3F  3A  F  A  A  3A  EKMQ  
    T  Thr  3F  3A  F  A  A  3A  EKMQ  
    T  Thr  3F  3A  F  A  A  3A  EKMQ  
    H  His  3Bb  3E  _B  E  E  3E  S  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    P  Pro  3F  3A  F  A  A  3A  EKMQ  
    R  Arg  4C  3D  c  D  z  z  ds  
    S  Ser  3E  3Bb  E  _B  _B  3Bb  H  
    P  Pro  3F  3A  F  A  A  3A  EKMQ  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    R  Arg  4C  3D  c  D  z  z  ds  
    D  Asp  3G  3G  G  G  G  3G  DILN  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    G  Gly  2A  4F  A,  f  z  z  ds  
    A  Ala  3C  4D  C  d  d  4D  W  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    S  Ser  3E  3Bb  E  _B  _B  3Bb  H  
    L  Leu  3G  3G  G  G  G  3G  DILN  
    I  Ile  3G  3G  G  G  G  3G  DILN  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    E  Glu  3A  3F  A  F  F  3F  CPTV  
    T  Thr  3F  3A  F  A  A  3A  EKMQ  
    G  Gly  2A  4F  A,  f  z  z  ds  
    Q  Gln  3A  3F  A  F  F  3F  CPTV  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    K  Lys  3A  3F  A  F  F  3F  CPTV  
    I  Ile  3G  3G  G  G  G  3G  DILN  
               z  z  ds  
    nbr                  
    CodeFasta                
    92.000000                

    
    
    Fichier abc de la protéodie stimulatrice de GNRH cf %BASE%\proteodie\fic\abc\GNRH_sti.abc
    Fichier abc de la protéodie inhibitrice de GNRH cf %BASE%\proteodie\fic\abc\GNRH_inh.abc
    Code abc de la protéodie stimulatrice de GNRH

    A A F G A A G G C A, G G G G F d F F A A, F E E A _B d E c A, G c F A, A, A c G C A G G G G E B A A G F A A F A, A G C A F A c B A F F F _B A F c E F G c G G A A, C G A E G G A A A F A, A A A G

    Code abc de la protéodie inhibitrice de GNRH

    F F A G F F G G d f G G G G A C A A F f A _B _B F E C _B D f G D A f f F D G d F G G G G _B _E F F G A F F A f F G d F A F D _E F A A A E F A D _B A G D G G F f d G F _B G G F F F A f F F F G

    Fichier txh de la partition de la protéodie stimulatrice de GNRH cf %BASE%\proteodie\partition\txh\GNRH_sti_part.txh
    hominhFichier txh de la partition de la protéodie de GNRH cf %BASE%\proteodie\partition\txh\GNRH_sti_part.txh

    Atelier tableau homologie  tpt :atelier template d'édition des chaînes de rechercher d'une homologie de protéodie après exécution les fichiers sont dans

    CodeFastaCodeAANote_sti_GBNote_inh_GBregexp_stiregexp_inh
    attention:action: insérer ici le code FASTA de la protéine, une ligne par lettre de l'acide aminé terminé par un point-virgule macro vim proteodie 

    Tableau proteodie :tableau des protéodies des acides aminés tableau acide amine 

    CodeFastaCodeAAacide_aminé  Note_sti_GBFreq_stiHz_stiMasse  Note_sti_FR  note_stiregexp_stiNote_inh_GBnote_inhFreq_inhHz_inhregexp_inhABC_stiABC_inhcouleur  coul_aacoloration  
    G  Gly  Glycine  2A   220.00 22075.06714  La, 2° octave  la()  G  4F  fa(+)   698.60 698  A,  f  rouge sombre  #6E0B14 Glycine  
    E  Glu  Glutamate  3A   440.00 440147.13074La, 3° octave  la  EKMQ  3F  fa()   349.23 349  A  F  vert  #008020 Glutamate  
    K  Lys  Lysine  3A   440.00 440146.18934La, 3° octave  la  EKMQ  3F  fa()   349.23 349  A  F  vert  #008020 Lysine  
    M  Met  Méthionine  3A   440.00 440149.20784La, 3° octave  la  EKMQ  3F  fa()   349.23 349  A  F  vert  #008020 Méthionine  
    Q  Gln  Glutamine  3A   440.00 440146.14594La, 3° octave  la  EKMQ  3F  fa()   349.23 349  A  F  vert  #008020 Glutamine  
    F  Phe  Phénylalanine  3B   493.88 494165.19184Si, 3° octave  si  FU  3Eb  mi (b)   311.13 311  B  _E  bleu  #0080FF Phénylalanine  
    U  Sel  Sélénocystéine3B   493.88 494168.053  Si, 3° octave  si  FU  3Eb  mi (b)   311.13 311  B  _E  cacao??  #614B3A Sélénocystéine 
    H  His  Histidine  3Bb   466.16 466155.15634Sib, 3° octavesi(b)  H  3E  mi   329.63 330  _B  E  vert_emeraude#01D758 Histidine  
    A  Ala  Alanine  3C   261.63 26289.09404  Do, 3° octave  do()  A  4D  ré(+)   523.25 587  C  d  vermillon  #DB1702 Alanine  
    S  Ser  Sérine  3E   329.63 330105.09344Mi, 3° octave  mi  S  3Bb  si(b)   466.16 466  E  _B  orange  #FF7F00 Sérine  
    C  Cys  Cystéine  3F   349.23 349121.15404Fa, 3° octave  fa()  CPTV  3A  la   440.00 440  F  A  ocre  #DD985C Cystéine  
    P  Pro  Proline  3F   349.23 349115.13194Fa, 3° octave  fa()  CPTV  3A  la   440.00 440  F  A  ocre  #DD985C Proline  
    T  Thr  Thréonine  3F   349.23 349119.12034Fa, 3° octave  fa()  CPTV  3A  la   440.00 440  F  A  ocre  #DD985C Thréonine  
    V  Val  Valine  3F   349.23 349117.14784Fa, 3° octave  fa()  CPTV  3A  la   440.00 440  F  A  ocre  #DD985C Valine  
    D  Asp  Aspartate  3G   392.00 392133.10384Sol, 3° octavesol  DILN  3G  sol   392.00 392  G  G  jaune_citron  #F7FF3C Aspartate  
    I  Ile  Isoleucine  3G   392.00 392131.17464Sol, 3° octavesol  DILN  3G  sol   392.00 392  G  G  jaune_citron  #F7FF3C Isoleucine  
    L  Leu  Leucine  3G   392.00 392131.17464Sol, 3° octavesol  DILN  3G  sol   392.00 392  G  G  jaune_citron  #F7FF3C Leucine  
    N  Asn  Asparagine  3G   392.00 392132.11904Sol, 3° octavesol  DILN  3G  sol   392.00 392  G  G  jaune_citron  #F7FF3C Asparagine  
    R  Arg  Arginine  4C   523.26 523174.20274Do, 4° octave  do(+)  RY  3D  ré()   293.66 294  c  D  indigo  #791CF8 Arginine  
    Y  Tyr  Tyrosine  4C   523.26 523181.19124Do, 4° octave  do(+)  RY  3D  ré()   293.66 294  c  D  indigo  #791CF8 Tyrosine  
    W  Trp  Tryptophane  4D   587.00 587204.22844Ré, 4° octave  ré(+)  W  3C  do()   261.63 262  d  C  violet  #7F00FF Tryptophane  
    z  abs  Absence  z            z  z          z  z       Vide  
    cat  nbr  nbr  nbr   nbr nbrnbr  nbr  nbr  nbr  nbr  nbr   nbr nbrnbr  nbr  nbr  nbr  nbr    
    CodeFastaCodeAAacide_aminé  Note_sti_GBFreq_stiHz_stiMasse  Note_sti_FR  note_stiregexp_stiNote_inh_GBnote_inhFreq_inhHz_inhregexp_inhABC_stiABC_inhcouleur  coul_aa  
    GEKMQFUHA22.00022.000000  22.000000   21.00 2121.00000021.000000  21.0000022.000000  22.000000  21.00000 21.00 210.000000  22.000022.000021.000000  21.0000  

    Tableau code genodic : code génodique officiel du brevet de Joël Sternheimer fichier code_genodic.xls transmis par genodics SA.

    fastanote_stiHz_stinote_inhHz_inhNote_sti_GBNote_inh_GB
    G  la   220fa(+)  698.002A  4F  
    A  do()   262ré(+)  587.003C  4D  
    S  mi   330si(b)  466.003E  3Bb  
    P  fa()   349la  440.003F  3A  
    V  fa()   349la  440.003F  3A  
    T  fa()   349la  440.003F  3A  
    C  fa()   349la  440.003F  3A  
    L  sol   392sol  392.003G  3G  
    I  sol   392sol  392.003G  3G  
    N  sol   392sol  392.003G  3G  
    D  sol   392sol  392.003G  3G  
    Q  la   440fa()  349.003A  3F  
    K  la   440fa()  349.003A  3F  
    E  la   440fa()  349.003A  3F  
    M  la   440fa()  349.003A  3F  
    H  si(b)   466mi  330.003Bb  3E  
    F  si   494mi (b)  311.003B  3Eb  
    U  si   494mi (b)  311.003B  3Eb  
    R  do(+)   523ré()  294.004C  3D  
    Y  do(+)   523ré()  294.004C  3D  
    W  ré(+)   587do()  262.004D  3C  
    nbr  nbr   nbrnbr   nbrnbr  nbr  
    fastanote_stiHz_stinote_inhHz_inhNote_sti_GBNote_inh_GB
    21.0021.00000 2121.00000 21.0021.000000  21.000000  

    Tableau proteodie note sti : FA majeur: Sib chaîne ABC "A,C EF GA B=B|d"

    Freq_stiNote_sti_FR  Note_sti_GBnb_acideABC_stijsnum
    220.00La, 2° octave  2A   1A,   0
    261.63Do, 3° octave  3C   3C   1
    329.63Mi, 3° octave  3E   1E   2
    349.23Fa, 3° octave  3F   4F   3
    392.00Sol, 3° octave3G   5G   4
    440.00La, 3° octave  3A   4A   5
    466.16La#, 3° octave3A#   1_B   6
    493.88Si, 3° octave  3B   1B   7
    523.25Ré, 4° octave  4D   1d   8
    nbr  nbr  nbr   somnbr    
    Freq_stiNote_sti_FR  Note_sti_GBnb_acideABC_sti  
    9.009.000000  9.000000   219.00000  

    Les symboles ^ = et _ sont utilisés (devant une note) pour générer respectivement un dièse un becarre ou un bémol.

    Tableau proteodie note inh : Si bémol majeur: Sib Mib chaîne ABC "CD _E=E FG AB|df"

    Freq_inhNote_inh_GBCodeFastaABC_inhjsnum
    261.633C   1C   0
    293.663D   2D   1
    311.133D#   1_E   2
    329.633E   1E   3
    349.233F   4F   4
    392.003G   5G   5
    440.003A   4A   6
    466.163A#   1_B   7
    523.254D   1d   8
    698.604F   1f   9
    nbr  nbr   somnbr    
    Freq_inhNote_inh_GBCodeFastaABC_inh  
    10.0010.000000   2110.0000  

    brevet_proteodie_sternheimer_EP0648275B1.pdf

    76 octaves

    stimulation: Gly=la grave Ala=do Ser=mi Pro,Val,Thr,Cys=fa Leu,Ile,Asn,Asp=sol Gln,Lys,Glu,Met=la His=si bémol Phe,SeC=si Arg,Tyr=do Trp=ré aigu

    Freq_stiNote_sti_FR  ABC_stiCodeFasta
    220.00La, 2° octave  A,   1
    261.63Do, 3° octave  C   3
    329.63Mi, 3° octave  E   1
    349.23Fa, 3° octave  F   4
    392.00Sol, 3° octaveG   4
    440.00La, 3° octave  A   4
    466.16La#, 3° octave_B   1
    493.88Si, 3° octave  B   2
    523.25Ré, 4° octave  d   1
    nbr  nbr  nbr   som
    Freq_stiNote_sti_FR  ABC_stiCodeFasta
    9.009.000000  9.00000 21

    inhibition: Trp=do Arg,Tyr=ré Phe,SeC=mi bemol His=mi Gln,Lys,Glu,Met=fa Leu,Ile,Asn,Asp=sol Pro,Val,Thr,Cys=la Ser=mi bemol Ala=ré aigu Gly=fa aigu

    Tableau acide amine ctl 

    acide_aminéFASTACodeAAMasse(Da) CodeAA_proteodie
    Alanine  A  Ala  89.09404  Ala  
    Arginine  R  Arg  174.20274Arg  
    Asparagine  N  Asn  132.11904Asn  
    Aspartate  D  Asp  133.10384Asp  
    Cystéine  C  Cys  121.15404Cys  
    Glutamate  E  Glu  147.13074Glu  
    Glutamine  Q  Gln  146.14594Gln  
    Glycine  G  Gly  75.06714  Gly  
    Histidine  H  His  155.15634His  
    Isoleucine  I  Ile  131.17464Ile  
    Leucine  L  Leu  131.17464Leu  
    Lysine  K  Lys  146.18934Lys  
    Méthionine  M  Met  149.20784Met  
    Phénylalanine  F  Phe  165.19184Phe  
    Proline  P  Pro  115.13194Pro  
    Pyrrolysine  O  Pyl  255.31    
    Sélénocystéine  U  Sel  168.053  Sel  
    Sérine  S  Ser  105.09344Ser  
    Thréonine  T  Thr  119.12034Thr  
    Tryptophane  W  Trp  204.22844Trp  
    Tyrosine  Y  Tyr  181.19124Tyr  
    Valine  V  Val  117.14784Val  
    nbr  nbr  nbr  nbr  nbr  
    acide_aminéFASTACodeAAMasse(Da) CodeAA_proteodie
    22.00000022.0022.00022.00000021.000000  

    Test proteodie 

    alpha 1 antitrypsine(Alpha-1 antitrypsin)  wikipedia_alpha_1_antitrypsine_

    Code  AcideNom AcideNote stimulatriceFréquenceNote stimulatrice  Note  Fréquence
    FastaaminéAminé  Ecriture anglaise  Ecriture françaiseinhibitrice  
    M  Met    3A   440.00La, 3° octave  3F   349.23
    P  Pro    3F   349.23Fa, 3° octave  3A   440.00
    S  Ser    3E   329.63Mi, 3° octave  3A#   466.16
    S  Ser    3E   329.63Mi, 3° octave  3A#   466.16
    V  Val    3F   349.23Fa, 3° octave  3A   440.00
    S  Ser    3E   329.63Mi, 3° octave  3A#   466.16
    W  Trp    4D   523.25Ré, 4° octave  3C   261.63
    G  Gly    2A   220.00La, 2° octave  4F   698.60
    nbr                
    Code                
    8.000              

    Atelier tableau proteodie aa  : acide aminés après exécution les fichiers sont dans domaine abc file 

    CodeFastaCodeAANote_sti_GBNote_inh_GBABC_stiABC_inh
    G  Gly  2A  4F  A,  f  
    E  Glu  3A  3F  A  F  
    K  Lys  3A  3F  A  F  
    M  Met  3A  3F  A  F  
    Q  Gln  3A  3F  A  F  
    F  Phe  3B  3Eb  B  _E  
    U  Sel  3B  3Eb  B  _E  
    H  His  3Bb  3E  _B  E  
    A  Ala  3C  4D  C  d  
    S  Ser  3E  3Bb  E  _B  
    C  Cys  3F  3A  F  A  
    P  Pro  3F  3A  F  A  
    T  Thr  3F  3A  F  A  
    V  Val  3F  3A  F  A  
    D  Asp  3G  3G  G  G  
    I  Ile  3G  3G  G  G  
    L  Leu  3G  3G  G  G  
    N  Asn  3G  3G  G  G  
    R  Arg  4C  3D  C  D  
    Y  Tyr  4C  3D  C  D  
    W  Trp  4D  3C  d  C  
    nbr            
    CodeFasta          
    21.000000          

    
    
    Code fasta des acides aminés

    GEKMQFUHASCPTVDILNRYW

    Protéodie stimulatrice de les acides aminés cf %BASE%\proteodie\fic\abc\acides_amines_sti.abc
    Protéodie inhibitrice de les acides aminés cf %BASE%\proteodie\fic\abc\acides_amines_inh.abc
    Protéodie stimulatrice de les acides aminés

    A, A A A A B B _B C E F F F F G G G G C C d

    Protéodie inhibitrice de les acides aminés

    f F F F F _E _E E d _B A A A A G G G G D D C

    Partition de la protéodie stimulatrice de les acides aminés cf %BASE%\proteodie\partition\txh\acides_amines_sti_part.txh
    Partition de la protéodie inhibitrice de les acides aminés cf %BASE%\proteodie\partition\txh\acides_amines_inh_part.txh

    Tableau histogramme note proteodie 

    Note_sti_GBcountFreq_stihisto_note  
    2A   391220.00  €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€
    3C   139261.63  €€€€€€€€€€€€€€€€€€  
    3E   60329.63  €€€€€€€€  
    3F   388349.23  €€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€€
    3G   166392.00  €€€€€€€€€€€€€€€€€€€€€  
    3A   194440.00  €€€€€€€€€€€€€€€€€€€€€€€€€  
    3Bb   9466.16  €€  
    3B   27493.88  €€€€  
    4C   84523.26  €€€€€€€€€€€  
    4D   6587.00  €  
    nbr   nbrsom  nbr  
    Note_sti_GBcountFreq_stihisto_note  
    10.000000 104062.79010.000000  

    Atelier proteodie batch : :20170525

    Atelier one line fasta 

    ligne_importee    
    MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGT  
    IDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPGELAEIFRASGEHVTDEEIESLMKDGD  
    KNNDGRIDFDEFLKMMEGVQ    
    nbr    
    ligne_importee    
    3.000000  

    
    
    Code fasta sur une ligne dans fichier 0.000000ic_oneline_fasta%
    Code fasta sur une ligne

    MTDQQAEARSYLSEEMIAEFKAAFDMFDADGGGDISVKELGTVMRMLGQTPTKEELDAIIEEVDEDGSGTIDFEEFLVMMVRQMKEDAKGKSEEELAECFRIFDRNADGYIDPGELAEIFRASGEHVTDEEIESLMKDGDKNNDGRIDFDEFLKMMEGVQ

    Spécification de proteodie gen 

  • 02/08/2017 on commente la génération des homologies d'inhibition pour les fichiers midi et abc car elle rends inutilisable les fichiers pour l'écoute.
  • 03/08/2017 16:43:08 mise en place des homologies d'inhibition pour les fichiers de partition .txh atelier proteodie tab tpt 
    • il faut générer la suite des liens vers les notes de la même façon que pour la protéodie stimulatrice
    • prévoir le silence
    • générer les notes avec mention de l'acide aminés pour le nom GB inh et sti
    • générer les notes avec mention de l'expression régulière de la note inhibitrice Homologie inhibitrice : tableau proteo image note hominh 

    Atelier proteodie gen : atelier de génération de protéodie

    tableau  résultat  commentaire  formulevariable  valeur résultat étendue  commande etendue (attention: décommentez puis recommentez et supprimer les colonnes supplémentaires ensuite si utilisation nécessaire)  
    :1!notepad %fic_tmp_prot%    ouverture notepad fichier pour copier-coller nom protéine sur la première ligne et code fasta sur les lignes suivantes      :1!notepad g:\mt\proteodie\tmp\proteodie_name_fasta.txt  
    f:1:\rf\%fic_tmp_prot%  phenylalanine ammonia lyase 1 Pisum sativum  récupération et formatage du nom de la protéine    v:NOMPROT:1:  phenylalanine ammonia lyase 1 Pisum sativum  f:1:\rf\g:\mt\proteodie\tmp\proteodie_name_fasta.txt  
    f:1:\nnf\%NOMPROT%  phenylalanine_ammonia_lyase_1_Pisum_sativum  récupération et formatage du code de la protéine (chaîne avec délimiteur underscore)    v:PROTEINE:1: phenylalanine_ammonia_lyase_1_Pisum_sativum  f:1:\nnf\troponin_c_homo_sapiens  
    a:NOMPROT:1  phenylalanine ammonia lyase 1 Pisum sativum  nom de la protéine      phenylalanine ammonia lyase 1 Pisum sativum  a:NOMPROT:1  
    a:PROTEINE:1  phenylalanine_ammonia_lyase_1_Pisum_sativum  code de la protéine      phenylalanine_ammonia_lyase_1_Pisum_sativum  a:PROTEINE:1  
    :1!copy %fic_tmp_prot% %fasta_dir%\%PROTEINE%_nom_fasta.txt  1 fichier(s) copié(s).  sauvegarde du fichier texte contenant le nom et le code fasta      1 fichier(s) copié(s).  :1!copy %fic_oneline_prod_fasta% g:\mt\proteodie\fasta\troponin_c_homo_sapiens_nom_fasta.txt  
    v:fic_pro_txh:%txh_dir%\%PROTEINE%.txh  1 fichier(s) copié(s).  recopie de la log dans le fichier txh de la protéodie      1 fichier(s) copié(s).  v:fic_pro_txh:g:\mt\proteodie\txh\troponin_c_homo_sapiens.txh  
    x:tableau entete proteodie txh :    appel de l'atelier d'entete du fichier txh de la protéodie        x:tableau entete proteodie txh :  
    v:fic_tmp_fasta:%fic_tmp_prot_fasta%            a:fic_tmp_fasta:g:\mt\proteodie\tmp\proteodie_fasta.txt  
    :1!tail --lines=+2 %fic_tmp_prot% >%fic_tmp_fasta%    extraction du code fasta dans un fichier        :1!tail --lines=+2 g:\mt\proteodie\tmp\proteodie_name_fasta.txt >g:\mt\proteodie\tmp\proteodie_fasta.txt  
    v:fic_oneline_fasta:%fic_oneline_prot_fasta%            v:fic_oneline_fasta:%fic_oneline_prod_fasta%  
    x:atelier one line fasta :    appel de l'atelier composant le code fasta sur une ligne        x:atelier one line fasta :  
    :1!sed -e "s/\(.\)/\1%PV%/g" %fic_oneline_prot_fasta% | perl %BASE%\fic\pl\transpo_csv.pl >%fic_csv_fasta%   formatage csv        :1!sed -e "s/\(.\)/\1  
    x:atelier proteodie tab tpt :    appel de l'atelier de génération des fichiers abc et partition html de protéodie        x:atelier proteodie tab tpt :  
    x:tableau histogramme note proteodie :    histogramme des notes pour le timbre de la protéodie        x:tableau histogramme note proteodie :  
    a:FICPROT_STI:1  %abc_dir%\%PROTEINE%_sti.abc  chemin du fichier abc de la protéodie stimulatrice      g:\mt\proteodie\fic\abc\phenylalanine_ammonia_lyase_1_Pisum_sativum_sti.abc  a:FICPROT_STI:1  
    a:FICPROT_INH:1  %abc_dir%\%PROTEINE%_inh.abc  chemin du fichier abc de la protéodie inhibitrice      g:\mt\proteodie\fic\abc\phenylalanine_ammonia_lyase_1_Pisum_sativum_inh.abc  a:FICPROT_INH:1  
    a:LOGCSV:1  g:\mt\proteodie\log\log_proteodie_gen_atl.txt  chemin de la log d'exécution de l'atelier      g:\mt\proteodie\log\log_proteodie_gen_atl.txt  a:LOGCSV:1  
    :1!perl %BASE%\fic\pl\mt_to_htm.pl %part_txh_dir%\%PROTEINE%_sti_part.txh  BASE=g:\mt,date_jour=20170924_173031  génération du fichier html de la partition stimulatrice      BASE=g:\mt,date_jour=20170924_173031  :1!perl g:\mt\fic\pl\mt_to_htm.pl g:\mt\proteodie\partition\txh\troponin_c_homo_sapiens_sti_part.txh  
    :1!perl %BASE%\fic\pl\mt_to_htm.pl %part_txh_dir%\%PROTEINE%_inh_part.txh  BASE=g:\mt,date_jour=20170924_173032  génération du fichier html de la partition inhibitrice      BASE=g:\mt,date_jour=20170924_173032  :1!perl g:\mt\fic\pl\mt_to_htm.pl g:\mt\proteodie\partition\txh\troponin_c_homo_sapiens_inh_part.txh  
    :1!echo %part_txh_dir%\%PROTEINE%_sti_part.txh  g:\mt\proteodie\partition\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum_sti_part.txh  chemin du fichier html de la partition stimulatrice      g:\mt\proteodie\partition\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum_sti_part.txh  :1!echo troponin_c_homo_sapiens_sti_part.txh  
    :1!echo %part_txh_dir%\%PROTEINE%_inh_part.txh  g:\mt\proteodie\partition\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum_inh_part.txh  chemin du fichier html de la partition inhibitrice      g:\mt\proteodie\partition\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum_inh_part.txh  :1!echo troponin_c_homo_sapiens_inh_part.txh  
    :1!%WEBEXE% %part_txh_dir%\%PROTEINE%_sti_part_txh.htm            :1!start C:\prg\Firefox\firefox.exe g:\mt\proteodie\partition\txh\troponin_c_homo_sapiens_sti_part_txh.htm  
    _:1!%WEBEXE% %part_txh_dir%\%PROTEINE%_inh_part_txh.htm            :1!start C:\prg\Firefox\firefox.exe g:\mt\proteodie\partition\txh\troponin_c_homo_sapiens_inh_part_txh.htm  
    :1!%DISKBASE% & cd %abc_dir% & %abc2mid_exe% %PROTEINE%_sti.abc -o %PROTEINE%_sti.mid  writing MIDI file ocytocine_sti.mid  génération du fichier midi pour la stimulation      writing MIDI file ocytocine_sti.mid  :1!g: & cd g:\mt\proteodie\fic\abc & g:\mt\share\abc2mid\abc2midi.exe troponin_c_homo_sapiens_sti.abc -o troponin_c_homo_sapiens_sti.mid  
    :1!%DISKBASE% & cd %abc_dir% & %abc2mid_exe% %PROTEINE%_inh.abc -o %PROTEINE%_inh.mid  writing MIDI file ocytocine_inh.mid  génération du fichier midi pour la l'inhibition      writing MIDI file ocytocine_inh.mid  :1!g: & cd g:\mt\proteodie\fic\abc & g:\mt\share\abc2mid\abc2midi.exe troponin_c_homo_sapiens_inh.abc -o troponin_c_homo_sapiens_inh.mid  
    :1!move %abc_dir%\%PROTEINE%_sti.mid %mid_dir%\%PROTEINE%_sti.mid    ouverture sous le browser html WEBEXE de la partition stimulatrice        :1!move g:\mt\proteodie\fic\abc\troponin_c_homo_sapiens_sti.mid g:\mt\proteodie\fic\mid\troponin_c_homo_sapiens_sti.mid  
    :1!move %abc_dir%\%PROTEINE%_inh.mid %mid_dir%\%PROTEINE%_inh.mid    ouverture sous le browser html WEBEXE de la partition inhibitrice        :1!move g:\mt\proteodie\fic\abc\troponin_c_homo_sapiens_inh.mid g:\mt\proteodie\fic\mid\troponin_c_homo_sapiens_inh.mid  
    :1!echo %mid_dir%\%PROTEINE%_sti.mid  g:\mt\proteodie\fic\mid\phenylalanine_ammonia_lyase_1_Pisum_sativum_sti.mid  chemin du fichier midi pour la stimulation      g:\mt\proteodie\fic\mid\phenylalanine_ammonia_lyase_1_Pisum_sativum_sti.mid  :1!echo g:\mt\proteodie\fic\mid\troponin_c_homo_sapiens_sti.mid  
    :1!echo %mid_dir%\%PROTEINE%_inh.mid  g:\mt\proteodie\fic\mid\phenylalanine_ammonia_lyase_1_Pisum_sativum_inh.mid  chemin du fichier midi pour la l'inhibition      g:\mt\proteodie\fic\mid\phenylalanine_ammonia_lyase_1_Pisum_sativum_inh.mid  :1!echo g:\mt\proteodie\fic\mid\troponin_c_homo_sapiens_inh.mid  
    a:LOGCSV:1  g:\mt\proteodie\log\log_proteodie_gen_atl.txt  chemin de la log d'exécution de l'atelier      g:\mt\proteodie\log\log_proteodie_gen_atl.txt  a:LOGCSV:1  
    x:tableau enpied proteodie txh :    appel de l'atelier d'enpied du fichier txh de la protéodie        x:tableau entete proteodie txh :  
    :1!echo %fic_pro_txh%  g:\mt\proteodie\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum.txh  chemin du fichier txh de la protéodie      g:\mt\proteodie\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum.txh  :1!echo g:\mt\proteodie\txh\troponin_c_homo_sapiens.txh  
    :1!copy %fic_pro_txh%+%LOGCSV% %fic_pro_txh%  g:\mt\proteodie\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum.txh 0 fichier(s) copié(s). alimentation du fichier txh des tableaux de la protéodie avec la log      g:\mt\proteodie\txh\phenylalanine_ammonia_lyase_1_Pisum_sativum.txh 0 fichier(s) copié(s). :1!copy g:\mt\proteodie\txh\troponin_c_homo_sapiens.txh+g:\mt\proteodie\log\log_proteodie_gen_atl.txt g:\mt\proteodie\txh\troponin_c_homo_sapiens.txh
    :1!perl %BASE%\fic\pl\mt_to_htm.pl %fic_pro_txh%  BASE=g:\mt,date_jour=20170924_173034  génération du fichier html des tableaux de la protéodie      BASE=g:\mt,date_jour=20170924_173034  :1!perl g:\mt\fic\pl\mt_to_htm.pl g:\mt\proteodie\txh\troponin_c_homo_sapiens.txh  
    _:1!%WEBEXE% %txh_dir%\%PROTEINE%_txh.htm    ouverture sous le browser html WEBEXE du fichier de la protéodie        :1!start C:\prg\Firefox\firefox.exe g:\mt\proteodie\txh\troponin_c_homo_sapiens_txh.htm  
    _:1!start notepad %FICPROT_STI%    ouverture fichier abc sti        :1!_start notepad g:\mt\proteodie\fic\abc\troponin_c_homo_sapiens_sti.abc  
    _:1!start notepad %FICPROT_INH%    ouverture fichier abc inh        :1!_start notepad g:\mt\proteodie\fic\abc\troponin_c_homo_sapiens_inh.abc  

    Atelier exploitation homologie reg  gen : atelier de génération des expressions régulières de génération des protéodies

    tableau  résultat  commentaire  formulevariable  valeur résultat étendue  
    :1!notepad %fic_tmp_regexp%    ouverture notepad fichier pour copier coller nom protéine sur la première ligne et code fasta sur les lignes suivantes      
    f:1:\rf\%fic_tmp_regexp%  test grep sequence_du_pois_Pisum_Sativum  récupération et formatage du nom de la protéine    v:NOMPROT:1:  test grep sequence_du_pois_Pisum_Sativum  
    f:1:\nnf\%NOMPROT%  test_grep_sequence_du_pois_Pisum_Sativum  récupération et formatage du nom de la protéine    v:PROTEINE:1: test_grep_sequence_du_pois_Pisum_Sativum  
    a:NOMPROT:1  test grep sequence_du_pois_Pisum_Sativum        test grep sequence_du_pois_Pisum_Sativum  
    a:PROTEINE:1  test_grep_sequence_du_pois_Pisum_Sativum        test_grep_sequence_du_pois_Pisum_Sativum  
    :1!tail --lines=+2 %fic_tmp_regexp% >%fic_tmp_regexp_fasta%    extraction du code fasta dans un fichier        
    v:fic_tmp_fasta:%fic_tmp_regexp_fasta%            
    x:atelier one line fasta :    appel de l'atelier composant le code fasta sur une ligne        
    v:fic_oneline_fasta:%fic_oneline_regexp_fasta%            
    :1!copy %fic_oneline_regexp_fasta% %rech_homolog_txh_dir%\%PROTEINE%_sequence.txt  1 fichier(s) copié(s).        1 fichier(s) copié(s).  
    :1!sed -e "s/\(.\)/\1%PV%/g" %fic_oneline_regexp_fasta% | perl %BASE%\fic\pl\transpo_csv.pl >%fic_csv_regexp_fasta%   formatage csv        
    x:atelier homologie tab tpt :    appel de l'atelier d'édition des expressions régulières d'homologies de protéodie        
    a:FICREGEXP_STI:1  %rech_homolog_txh_dir%\%PROTEINE%_sti_regexp.txt        g:\mt\proteodie\homologie\regexp\test_grep_sequence_du_pois_Pisum_Sativum_sti_regexp.txt
    a:FICREGEXP_INH:1  %rech_homolog_txh_dir%\%PROTEINE%_inh_regexp.txt        g:\mt\proteodie\homologie\regexp\test_grep_sequence_du_pois_Pisum_Sativum_inh_regexp.txt
    a:LOGCSV:1  g:\mt\proteodie\log\log_homologie_gen_atl.txt        g:\mt\proteodie\log\log_homologie_gen_atl.txt  
    :1!start notepad %FICREGEXP_STI%    ouverture notepad fichier pour copier coller nom protéine sur la première ligne et code fasta sur les lignes suivantes      
    :1!start notepad %FICREGEXP_INH%    ouverture notepad fichier pour copier coller nom protéine sur la première ligne et code fasta sur les lignes suivantes      
    :1!echo %FICREGEXP_STI%  g:\mt\proteodie\homologie\regexp\test_grep_sequence_du_pois_Pisum_Sativum_sti_regexp.txtouverture notepad fichier pour copier coller nom protéine sur la première ligne et code fasta sur les lignes suivantes    g:\mt\proteodie\homologie\regexp\test_grep_sequence_du_pois_Pisum_Sativum_sti_regexp.txt
    :1!echo %FICREGEXP_INH%  g:\mt\proteodie\homologie\regexp\test_grep_sequence_du_pois_Pisum_Sativum_inh_regexp.txtouverture notepad fichier pour copier coller nom protéine sur la première ligne et code fasta sur les lignes suivantes    g:\mt\proteodie\homologie\regexp\test_grep_sequence_du_pois_Pisum_Sativum_inh_regexp.txt